PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_D30ADBFDE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 240aa    MW: 27025.7 Da    PI: 10.5279
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_D30ADBFDE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10113158550
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                            kr +r   NR +A+rsR RK+++i eLe+ v  L+ e +aL  ++ 
  Traes_5DL_D30ADBFDE.1 113 KRVKRILANRQSAQRSRVRKLQYISELERSVTGLQMEVSALSPRVA 158
                            8999*******************************99999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-11109173IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.461111167IPR004827Basic-leucine zipper domain
PfamPF001702.7E-9113161IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11113167No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-13113167No hitNo description
CDDcd147033.76E-19114164No hitNo description
PROSITE patternPS000360116131IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MAQLPPRAPS AGGQXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XEAEEGTPSA GAMAAADGFG DPKRVKRILA  120
NRQSAQRSRV RKLQYISELE RSVTGLQMEV SALSPRVAFL DHQRSLLTVG NSHLRQRIAA  180
LAQDKIFKDA HQEALKEEIE RLRQLFHHQK IKATGGTDMA TAASMQAKQE LLMCEGAAMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572005.12e-83PREDICTED: basic leucine zipper 19
SwissprotQ6K3R93e-80BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLW5FZ391e-102W5FZ39_WHEAT; Uncharacterized protein
STRINGMLOC_39203.11e-99(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-54bZIP family protein